Protein Info for CA264_05645 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: L-serine dehydratase, iron-sulfur-dependent subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00719: L-serine dehydratase, iron-sulfur-dependent, beta subunit
  • amino acids 4 to 201 (198 residues), 203.5 bits, E=1.6e-64
• PF03315: SDH_beta
  • amino acids 6 to 85 (80 residues), 47.8 bits, E=1e-16

Best Hits

Swiss-Prot: 47% identical to SDHAB_BACSU: Probable L-serine dehydratase, beta chain (sdaAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 71% identity to mtt:Ftrac_1031)

MetaCyc: 34% identical to L-serine dehydratase beta subunit (Peptoniphilus asaccharolyticus)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-methionine biosynthesis II (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See A0A1X9YPY8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>CA264_05645 L-serine dehydratase, iron-sulfur-dependent subunit beta (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEKSSVFDMIGPVMIGPSSSHTAGVVRIARAAIRILGAAPEEATITFYNSFARTYEGHG
SDRAIIAGLLDFKTDDKRIKEAFDHAKERGLKYTFRSVGNASTMHPNTIKLNLKANDREV
EVIGQSRGGGVINISEVDGFSSSFSATLHTLIIDAADVKGSIAFIASVLAHDDCNIATMN
VSRKGRNEQARQFIEMDSGIKPITLEYLKQLDWVKHVIYIPNIDL