Protein Info for CA264_05630 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 3 to 106 (104 residues), 36.1 bits, E=1.7e-12
• PF01210: NAD_Gly3P_dh_N
  • amino acids 3 to 161 (159 residues), 110.5 bits, E=1.7e-35
• PF07479: NAD_Gly3P_dh_C
  • amino acids 181 to 318 (138 residues), 157.2 bits, E=6.3e-50
• PF20618: GPD_NAD_C_bact
  • amino acids 241 to 307 (67 residues), 77.6 bits, E=1.7e-25

Best Hits

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 61% identity to chu:CHU_1307)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See A0A1X9YQ12 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CA264_05630 glycerol-3-phosphate dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKVAVIGGGSWATALVKILSENKSQINWWMRNADDVQHLINYRHNPRYLSQVSFDLNYV
KPSTDIQAVVASSDWVILAVPAAFVQLALADLPADAFAGKVIVSAIKGMIPRENILITEY
MERAYAVPNSHQLVIAGPCHAEEVALEKQSYLTIGSHDMTTAERFCALLRNRYVKANPLD
DLDGIEYCAVMKNVIALACGIARGLNFGDNFQAVLVSNAMFEIERFLDSIMPIHRDLSGS
AYLGDLLVTAYSQFSRNRTFGNMIGRGYTVKSAQVEMNMVAEGYYAVQSIYELNKKLQVA
MPITDAVYHILYERIAPAVEFEILKDKFR