Protein Info for CA264_05615 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF00293: NUDIX" amino acids 3 to 115 (113 residues), 62.4 bits, see alignment E=4.6e-21 PF14815: NUDIX_4" amino acids 5 to 120 (116 residues), 57 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 50% identity to geo:Geob_2829)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPZ7 at UniProt or InterPro

Protein Sequence (128 amino acids)

>CA264_05615 NUDIX hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKVICALLEQHGRVLVTQRSENMREPLLWEFPGGKLEAGESEQECLVRELREELTLSVEP
VLRLSPVVHHSPDRTIELIPYICMYHGGAIQLIEHRAYQWAKQDELPNYAWCPADLPIVQ
EYLALKRG