Protein Info for CA264_05580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF02622: DUF179" amino acids 19 to 173 (155 residues), 153.8 bits, see alignment E=2e-49

Best Hits

Swiss-Prot: 49% identical to Y495_SALRD: UPF0301 protein SRU_0495 (SRU_0495) from Salinibacter ruber (strain DSM 13855 / M31)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 51% identity to mtt:Ftrac_0222)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YQ03 at UniProt or InterPro

Protein Sequence (189 amino acids)

>CA264_05580 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MTDKKVIKPQNGSILISEPYLGDPNFERSVILLCSHEEEEGSFGLVLNRASNLNLSDVLD
VFDDDFDMNLGIGGPVQYNTLHYIHRLPDLPQAVKLGEDVYWGGDFETLRTMIDTGVVKK
DDIRFFLGYSGWTPGQLQEEIDKNVWIVNNNAANKLFNLDVETLWRSILREMGGKFKVLS
NYPEDPRLN