Protein Info for CA264_05545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tropinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 11 to 200 (190 residues), 180.3 bits, E=6.2e-57
• PF01370: Epimerase
  • amino acids 14 to 174 (161 residues), 29.6 bits, E=9.2e-11
• PF08659: KR
  • amino acids 14 to 169 (156 residues), 39.5 bits, E=1.2e-13
• PF13561: adh_short_C2
  • amino acids 20 to 249 (230 residues), 212.6 bits, E=1.3e-66

Best Hits

KEGG orthology group: K08081, tropine dehydrogenase [EC: 1.1.1.206] (inferred from 52% identity to psu:Psesu_2758)

MetaCyc: 31% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

No annotation

MetaCyc Pathways

• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (4/6 steps found)
• tropane alkaloids biosynthesis (2/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.206 or 1.1.1.304

Sequence Analysis Tools

See A0A1X9YPY3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CA264_05545 tropinone reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAQNRWLLTGKKAVVTGGSKGIGKATVKELIDLGAEVLAVARKQENLELLQQEHPERLHV
LSADVSNAEGRSKVAAYVQQEWGLLDVLVNNAGTNIRKPTADYSTEEYNFIMQTNLQSAF
ELNRLLYPLLKESEQGNIVHITSVAGLVHVRTGSIYGMTKAALTQLTRNLAAEWAKDRIR
VNAVAPWYIRTPLAQTVLQNQDFYDNVVGRTPMQKVGEPEDVAGAVAFLCLPAAAYITGQ
TIAVDGGFTINGFHP