Protein Info for CA264_05545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tropinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 11 to 200 (190 residues), 180.3 bits, see alignment E=6.2e-57 PF01370: Epimerase" amino acids 14 to 174 (161 residues), 29.6 bits, see alignment E=9.2e-11 PF08659: KR" amino acids 14 to 169 (156 residues), 39.5 bits, see alignment E=1.2e-13 PF13561: adh_short_C2" amino acids 20 to 249 (230 residues), 212.6 bits, see alignment E=1.3e-66

Best Hits

KEGG orthology group: K08081, tropine dehydrogenase [EC: 1.1.1.206] (inferred from 52% identity to psu:Psesu_2758)

MetaCyc: 31% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.206 or 1.1.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPY3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CA264_05545 tropinone reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAQNRWLLTGKKAVVTGGSKGIGKATVKELIDLGAEVLAVARKQENLELLQQEHPERLHV
LSADVSNAEGRSKVAAYVQQEWGLLDVLVNNAGTNIRKPTADYSTEEYNFIMQTNLQSAF
ELNRLLYPLLKESEQGNIVHITSVAGLVHVRTGSIYGMTKAALTQLTRNLAAEWAKDRIR
VNAVAPWYIRTPLAQTVLQNQDFYDNVVGRTPMQKVGEPEDVAGAVAFLCLPAAAYITGQ
TIAVDGGFTINGFHP