Protein Info for CA264_05450 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 PF04851: ResIII" amino acids 179 to 241 (63 residues), 23.5 bits, see alignment E=1.9e-08 PF13604: AAA_30" amino acids 180 to 252 (73 residues), 42.8 bits, see alignment E=2e-14 PF13086: AAA_11" amino acids 180 to 400 (221 residues), 210.1 bits, see alignment E=2e-65 PF13245: AAA_19" amino acids 184 to 397 (214 residues), 40 bits, see alignment E=1.7e-13 PF13087: AAA_12" amino acids 409 to 614 (206 residues), 197.7 bits, see alignment E=6.2e-62

Best Hits

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYB6 at UniProt or InterPro

Protein Sequence (647 amino acids)

>CA264_05450 DNA-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSEILYELKRVQELLKIEQEEDRQQYKIKSLKSTIAERKEMGFCWYPVTIAKEELGFGNK
VVLELERTKDRDQLHLFQVGKTAALFSNGSERQSLNGVIVGLKRNKVLLATNREDLPDWI
DEGRLGVDLTFDEMSYREMEIAMKKVIEAHKTRLAELRDILLGDVPAHFTDASMDDIPSL
NPSQNEAVRKIVQAKDVAIIHGPPGTGKTTTLVQAILKTLETQKRLLVTAPSNTAVDLLT
EKLANDGVNVIRIGNPSRVSDVLLEHTLDAQVMGHRSYKNLKEYRKTAEEYRRMAFQFKR
KFGHEERAQRQMYKMESKRLLEEADRVEEYITEDLLNNVQVITCTLVGAANKAIRHLEYD
TVFIDEAAQALEPGCWIPISRAKRVVLAGDHCQLPPTVKSFEAEQKGLGKTLFEKCIERQ
PDVSVMLKTQYRMHHHIMEFSNQQFYNGELKAHESVHSSDLHQYNPHFAPGLAVEFVDTA
GCGYNEVETPESSSSANPDEANLLLNHLTHLLKDYSQADAETEHLRIGVIAPYRAQINYL
EDRVEHIPQLHELRQKRQLSVGTVDSFQGQERDIIYISMTRSNEQGEIGFLADIRRMNVA
MTRAKKKMVVVGDSATLSQHPFYASFLNYVESINAYRSAWELQELMA