Protein Info for CA264_05360 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 340 to 367 (28 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 219 (199 residues), 102.5 bits, see alignment E=4e-33 PF02687: FtsX" amino acids 292 to 407 (116 residues), 86.4 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 48% identity to lby:Lbys_1337)

Predicted SEED Role

"ABC transporter efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPY5 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CA264_05360 ABC transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLLENIREGLRAIRSNLLRTILTGLIISIGIMSLVGILTAVDSMKYSLTQTFSNLGANA
FDIRRKGMNNRGSREGRVEKVYPQIDYNQARQYKEVMKDEARVSLSAFISGATIVKSESE
KTNPNISVVAADEDYMLNNNLNLAKGRDFSTFEQEQGTNVAIIGDELATTLFKNKDAIGE
YITFLGRRFKVVGQMEKAGSSMGGSSDRRVLIPLETGRQIPRTGNAELNFDIKTAIFRAN
ELNYVMGEATGKMRNIRQDALGQEDSFEIRRSDSLVQSLDEISGYLKWGGGVIGFITLLG
ASVGLMNIMMVSVNERTREIGVRKALGATAHQIRQQFLIEAIVICILGGLLGILLGVLMG
NGIALLIADGAGFFVPWLWVFVGLTICVLVGVISGYYPAFKASKLDPIESLRYE