Protein Info for CA264_05320 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: para-aminobenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF04715: Anth_synt_I_N" amino acids 81 to 128 (48 residues), 24.3 bits, see alignment 3.6e-09 PF00425: Chorismate_bind" amino acids 163 to 419 (257 residues), 281.7 bits, see alignment E=6.2e-88

Best Hits

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPV4 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CA264_05320 para-aminobenzoate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MVKTEILEKELPISLEEFRLKALAWADTYPLAAYYNPNNIPYPHQGFEHLLAVSGGAALP
LNEADAFGSLRKTLLAPHPLLCGYLGYDLKNQVEKLSSHNHDGIGFPLLTFFVPDLYLYF
NSESIRLYTSDRKANDIVAAICATATPAPATPAGIQVTQRVAREKYTRQVERIRQHILEG
DVYELNFCMEFYAEQVQLQPLPLYLALNAASPTPFSGYLKLQDKYLLCASPERFMKKEGQ
KLISQPIKGTIRRGSTPEEDKALQRQLRHDEKELAENMMIVDLVRNDLSRSCATGTVQVE
EMFGIYGFRQVSQMISTIVGELRAEKDLTDALSGTFPMGSMTGAPKISAMQLIEELEDTR
RGLYSGAFGYISGNGDCDFNVVIRSMQYNAGTGYLSFMVGSAITYDSDPNQEYEECLLKA
QAILKVLGQ