Protein Info for CA264_05315 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 36 to 475 (440 residues), 445.5 bits, see alignment E=2.4e-137 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 36 to 470 (435 residues), 429.5 bits, see alignment E=1.4e-132 PF00919: UPF0004" amino acids 36 to 135 (100 residues), 102 bits, see alignment E=2.3e-33 PF04055: Radical_SAM" amino acids 183 to 358 (176 residues), 86.8 bits, see alignment E=3e-28 PF01938: TRAM" amino acids 414 to 475 (62 residues), 37.7 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 70% identical to MIAB_CYTH3: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 72% identity to lby:Lbys_1149)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPY1 at UniProt or InterPro

Protein Sequence (476 amino acids)

>CA264_05315 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB (Pontibacter actiniarum KMM 6156, DSM 19842)
MDPIVDLDFIDNRTPEQAAACDTQVTGETNTGKTRKLYIESYGCAMNFSDSEIVSSIMFE
QGFDTTSDIAQADLVFLNTCSIREKAEQTVRNRLGQINYYKKKKPEMMIGVLGCMAERLK
KSLLEEEKIVDLVVGPDAYRDLPNLINEVDGGQKAVNVLLSREETYADINPIRLNSNGVS
AFISIMRGCDNMCSFCVVPFTRGRERSRDANSIVREAQQLVDNGYKEVTLLGQNVDSYKW
ASEDGAESVNFAQLLEKVALVSPDLRIRFSTSHPKDITDEVLYTMKKYDNICKYIHLPAQ
SGNSRVLELMNRTYDRAWYLNRVDAIRSILGEDCGISSDMIAGFCTETEEEHQDTLSLMD
YVQYDYSYMFFYSERPGTLAARKLEDDIPLEVKKRRLAEIIEKQRETSLNRNKRDVGKVH
RVLVENFSKKSDQQLSGRNDQNKVVIFDKKHYKKGDYVNVFVHDCSVGTLFGEAVD