Protein Info for CA264_05275 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 253 to 270 (18 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 390 (26 residues), see Phobius details amino acids 403 to 426 (24 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 21 to 217 (197 residues), 229.1 bits, see alignment E=5.9e-72 amino acids 246 to 457 (212 residues), 140.2 bits, see alignment E=5.2e-45 PF07690: MFS_1" amino acids 41 to 351 (311 residues), 87.6 bits, see alignment E=8.2e-29 PF00854: PTR2" amino acids 99 to 213 (115 residues), 121.1 bits, see alignment E=5.4e-39 amino acids 251 to 420 (170 residues), 95.1 bits, see alignment E=4.6e-31

Best Hits

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPW5 at UniProt or InterPro

Protein Sequence (482 amino acids)

>CA264_05275 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTSQNISGERAPSFVETQGTLFGHPKGLMVLFFTEMWERFSYYGMRGILVLFLVSNTKG
GYGWTSEEALELYGIYTMLVYLMSIPGGILADKVFGQKKAVIIGGFTLVAGHLLMAYPPQ
WAFYTALCLIVAGTGLLKPNISTMVGGLYKEGDSRRDSGFTIFYMGINMGALLASLIVGY
VGENYGWHLGFSLAGFGMVLGQVVFIWGRKFLRGVGDLTKEEKREDKIFTKDEPSTTTHG
GFLGFSRNEWDRIIAILISFIIVLVFWASFEQAGGLMNLYALQYTDRFVLGWEVPTAWLQ
GLNSFFIITMGGVVAALWIALAKRGKNPPSIFKMGLGTAVLGIGFIFMVFASLQRNSSAD
GLSSLHWLVFAYLFHTLGELALSPVSLSFITKVAPKRIVASMMGIYFAVTGFGNYLASLI
GIWAVRFGELEIFAYIAGFTIVLGIILMVLTKRINKLTHGMEDQKQDAKEAQTGQLLEAE
VS