Protein Info for CA264_05250 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 79 to 106 (28 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 142 to 158 (17 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 187 to 203 (17 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 332 to 349 (18 residues), see Phobius details amino acids 356 to 373 (18 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPW2 at UniProt or InterPro

Protein Sequence (538 amino acids)

>CA264_05250 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLMKLQSAANTTRVTRIVLVFVLLFAVLFFFTAHEGLYYSDDVQYSAFAGRLLNGSFDI
TQDGHTFIHRPTVYVPTAIAYAIFGVNYITYSLWTLLCTLGCIVLTYKAAHQKGLNPAFA
AVFLGLTFYFLYFINFLYPDNMVAFFTLVAATVYYRLYRGDNRRVLFKALVFTSSLFIAG
LAKETAVVVLPFFALCAARDVIGRKENTKFWAYAALFGLLLLSVYFGWYYLETGDAFYRV
SEMETANLSYDNYVTNPSRSYAKRLLWGPVEALLGTGAFMLVVFLIGGGSGLTEAEKRKK
LYWSLLFIVSYLTLCFSSTSLQVYNPIKLDARMYNLVIPPLAIAASFGLQKKVQEIRYTL
FYTFAFAAIALYLRNSVGAVHGLLALYFAAHTAWLYFRKHSRLPVAYTALAAITFCLLIR
PVYFMLKEKTLHYPEHLALFDKLQQLTAQRTKVQVILPHYLYKSTGYFTDYKKVNKLQFY
DYSNSIPPGRRGQQLLLLNRSLGTNPSFTEDGPYEQLLEHIAQKPPLWKQGPLELYEL