Protein Info for CA264_05240 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycerol acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01553: Acyltransferase
  • amino acids 28 to 136 (109 residues), 48.8 bits, E=3.2e-17

Best Hits

KEGG orthology group: None (inferred from 49% identity to mtt:Ftrac_0161)

MetaCyc: 37% identical to lysophosphatidylcholine acyltransferase (Xanthomonas campestris pv. campestris)
1-acylglycerophosphocholine O-acyltransferase. [EC: 2.3.1.23]

Predicted SEED Role

"Acyltransferase family protein"

MetaCyc Pathways

• phosphatidylcholine biosynthesis VII (1/2 steps found)
• phosphatidylcholine acyl editing (2/4 steps found)
• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)
• representative whole plasma arachidonate-derived icosanoids I (1/13 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.23

Sequence Analysis Tools

See A0A1X9YPS7 at UniProt or InterPro

Protein Sequence (183 amino acids)

>CA264_05240 glycerol acyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIAKFISKLFFKATGWTLNGTLTAENRRCVMIAAPHTSNWDFVYARAAFYLMDAPIRYTI
KKEFMQFPFGPLLKAMGALPIDRSKNTRMVDAMIRIFEETPGDMCVMVTPEGTRKYQPRW
RRGFYYVALGAKVPIVLGYLDYAKKEAGIGPTIIPTGDIEADMEKILAFYRTKTGKFPEQ
GVR