Protein Info for CA264_05130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR00492: alanine racemase" amino acids 5 to 383 (379 residues), 298.8 bits, see alignment E=2.6e-93 PF01168: Ala_racemase_N" amino acids 9 to 231 (223 residues), 178.3 bits, see alignment E=1.9e-56 PF00842: Ala_racemase_C" amino acids 255 to 380 (126 residues), 131.1 bits, see alignment E=1.9e-42

Best Hits

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 50% identity to mtt:Ftrac_0653)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPU4 at UniProt or InterPro

Protein Sequence (383 amino acids)

>CA264_05130 alanine racemase (Pontibacter actiniarum KMM 6156, DSM 19842)
MFHSSYIEISKSALQNNIDFLKQEIGPHVQFSSVIKGNAYGHGIEQFAPTAQECGVDHFS
VFSADEAQRLLQTLPRKATIMIMGYLDNPELEWAIQNDIEFFVFELDRLIAAADIAKKFG
KRAKVHLELETGMNRTGFDKSALEHAISTLDDCREHVELQGVCTHFAGAESLQNHERILD
QQRNYQEQLAHLQSSGHTPRQRHTACSAAMVTYPETHLDMVRIGIMQYGFWPSPETYRQY
IGQHMDKKDPLRRLINWKSRVMSLKSVPKGEYVGYGNSYQAPLDMVLAVVPVGYAWGYSR
ALSNQGQVLIKGVRAGVVGIVNMNVMMVDVTNIPDVQKNDEVVLLGIQGDESITVASFGE
LSTQLNYELLTRLPSNIPRYVID