Protein Info for CA264_05115 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01502: PRA-CH" amino acids 26 to 98 (73 residues), 114.3 bits, see alignment E=1.9e-37 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 114 to 196 (83 residues), 97.5 bits, see alignment E=2.1e-32 PF01503: PRA-PH" amino acids 115 to 200 (86 residues), 66.7 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 56% identical to HIS2_BACTN: Histidine biosynthesis bifunctional protein HisIE (hisI) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K11755, phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19 3.6.1.31] (inferred from 60% identity to pdi:BDI_2019)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.5.4.19, EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19 or 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPT0 at UniProt or InterPro

Protein Sequence (202 amino acids)

>CA264_05115 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MELDFEKAGGLVPAVIQDNLTGQVLMLGYMSQEALDKTRQEGLVTFFSRSKNRLWTKGET
SGNTLEVVSIARDCDNDSLLIKVKPNGPTCHTGSTSCFGEEESSNRVAAIRFIAQLEGVI
QERKTNPVEGSYTNFLYSKGVNKIAQKVGEEAVETVIDAVAGKLDTMKGEAADLLYHLLV
LLSATGLELKDVVAVLQERHKK