Protein Info for CA264_05110 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: imidazole glycerol phosphate synthase cyclase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 251 (251 residues), 361.1 bits, E=1.4e-112
• PF00977: His_biosynth
  • amino acids 5 to 234 (230 residues), 273.4 bits, E=1.5e-85

Best Hits

Swiss-Prot: 62% identical to HIS6_BACFR: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 68% identity to ppn:Palpr_1159)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

See A0A1X9YPP7 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CA264_05110 imidazole glycerol phosphate synthase cyclase subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MLTKRIIPCLDIKNGRTVKGVQFENIRDAGDPVELAKWYAEQGADELVFLDITATNEERK
TFAALVRDIARHIDIPFTVGGGIGAVADVEVLLHAGADKVSVNSSAIKNPQLVQELAKHF
GSQCVTVAIDTKYREETGWKVYTRAGTVETEHATIDWAKKVTDLGAGEILLTSMNNDGTK
AGFALDITGEVAQAVSVPVIASGGAGSMKHFAEAFNISHADAALAASLFHFRELGVPELK
SYLKEQGIAVRI