Protein Info for CA264_05105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 52% identical to HIS4_PARD8: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 56% identity to lby:Lbys_2915)

MetaCyc: 35% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPT9 at UniProt or InterPro

Protein Sequence (240 amino acids)

>CA264_05105 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MMEIIPAIDLIGGQCVRLTEGDFAQQTTYDSNPLEVAKRFEANGIKRLHLVDLDGARARK
PVNLHVLESIAANTNLTIDFGGGLQSDEAVKQAFDAGAAQITAGSIAVREPETVKNWLLK
YGADKIFIGADFKGTNIAISAWTEESKYPLQDFISGYVQTGAKLFICTDVSKDGKLQGPS
TSTYRHLKLTQPEAEVIASGGVTTVEDLEQLQEIGVKGAIIGKAIYEGTIELKDLVRFLC