Protein Info for CA264_05095 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 324 (28 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 378 to 406 (29 residues), see Phobius details amino acids 419 to 442 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 13 to 442 (430 residues), 360.1 bits, see alignment E=8.2e-112 PF03448: MgtE_N" amino acids 17 to 117 (101 residues), 80.6 bits, see alignment E=1.7e-26 PF00571: CBS" amino acids 184 to 238 (55 residues), 35 bits, see alignment 2.2e-12 PF01769: MgtE" amino acids 305 to 437 (133 residues), 128 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 63% identity to shg:Sph21_4296)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPR4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>CA264_05095 magnesium transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSQTSTDVNLRDLRHKHPNDIAETITELNAKERILAFLLLPGDMKGEVFTYFNRTVQEEV
LKELGSRETAAMLENMAPDDRTEIFENFPDLLIKESINFLSAEEKSIALNLLGYPEKSIA
RLMTPYYIQAKKGWTIKQALSNIKRYGKKAETLNHIYIVDKENKLVDDIRTGRLLMADED
QTIESLMDYEFISLTTTMNRDEAIEQFNKYDRAVMPVVSESGVLVGIVTFDDIFDEIERR
DTEDIQKFGGLEALELSYTETPLMTLVRKRASVLLILFLGEMLTASAMGFFEEEIAQAVV
LALFIPLIISSGGNSGSQAATLIVRAMAIKELGIKDWWYVMRKEVLSGLLLGLILGSVGF
LRILVWQQAGFYDYGEHAFLIGLTVGFSLIGIVLWGTLSGSMIPFLLQKLRLDPATSSAP
FVATLVDVTGLIIYFTIAASILRGTLL