Protein Info for CA264_05060 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 3 to 186 (184 residues), 177.4 bits, E=1.3e-56
• PF00117: GATase
  • amino acids 4 to 185 (182 residues), 173.9 bits, E=3.2e-55
• PF07722: Peptidase_C26
  • amino acids 72 to 170 (99 residues), 33 bits, E=5.5e-12

Best Hits

Swiss-Prot: 45% identical to PABA_ECOLI: Aminodeoxychorismate synthase component 2 (pabA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 62% identity to lan:Lacal_1738)

MetaCyc: 45% identical to aminodeoxychorismate synthase subunit 2 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (39/59 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

See A0A1X9YPN4 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_05060 glutamine amidotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVLVIDNYDSFTYNLVHLLQELGATVTVRRNDKTTLEEVGQHDKIMLSPGPGIPDEAGL
LKEIIRTYGPSKDLFGVCLGHQAIGEVYGGKLFNSNEVWHGVAMPVQVVCEQEPLFKDLP
KQFGTGRYHSWLVEQELPECLVPTAVDEKGHIMAMRHKEHKVRGVQFHPESVLTEHGKEI
IKNWLDS