Protein Info for CA264_04980 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02568: ThiI" amino acids 3 to 54 (52 residues), 27.4 bits, see alignment 6e-10 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 6 to 361 (356 residues), 313.9 bits, see alignment E=6e-98 PF03054: tRNA_Me_trans" amino acids 6 to 206 (201 residues), 240.3 bits, see alignment E=4e-75 PF20259: tRNA_Me_trans_M" amino acids 227 to 278 (52 residues), 55.7 bits, see alignment 7.3e-19 PF20258: tRNA_Me_trans_C" amino acids 298 to 361 (64 residues), 50.4 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 78% identical to MNMA_CYTH3: tRNA-specific 2-thiouridylase MnmA (mnmA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 79% identity to mtt:Ftrac_0476)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPR3 at UniProt or InterPro

Protein Sequence (375 amino acids)

>CA264_04980 tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTKGRVLVAMSGGIDSSVAAVMLHEQGYEVVGMTMKTWDYASSGASKKETGCCSLDSIN
DARNIAVQLGFPHYIIDIREEFGDFVINHFTDEYLAGRTPNPCVLCNTHIKWDALLRRAD
QLGCDYIATGHYANLRQENGRYVISKGLDENKDQSYALWGISQESLSRTIFPLGGLHKTE
IREMARERGFTELVNKPESYEICFIPDNDYRGFLKRRVEGLEERVAGGEFVLEDGTVVGK
HEGYPFYTIGQRKGLGVALGFPAYVTRIEKDNNRVVLGNYEELAKNAMTVGKLNMSKYEN
LVGQPIPTVTKVRYNDGGTEAIIEQEGDKMKVHFLSGVHAIAPGQAAVFYEGNDVVGGGW
IESNYNSEYNLNVLQ