Protein Info for CA264_04930 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA polymerase III subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 250 to 266 (17 residues), see Phobius details TIGR01128: DNA polymerase III, delta subunit" amino acids 18 to 338 (321 residues), 174.1 bits, see alignment E=2.2e-55 PF06144: DNA_pol3_delta" amino acids 21 to 191 (171 residues), 104.9 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 52% identity to chu:CHU_1537)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPN1 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CA264_04930 DNA polymerase III subunit delta (Pontibacter actiniarum KMM 6156, DSM 19842)
MAHTPENILEQLKQRQFAPVYFLQGEESYYIDTIADFIEEHALQEHEKGFNQVVLYGKDV
DVSTVLLQAKRFPMMSERSVVIVKEAQSIADIEKEEGMRQLEAYLQNPLPSTILVFCYKH
KTLDGRKALAKAVSKHAVLLTTKKLYDNQVPAWVNGYLKSKGMKASQQAVLLLSEFIGSD
LSRLANEIDKLLINLKPGATVDEGLVQENVGISKEYNIFELQSALIARDALKANQIIHYF
EANPKSNPLIPNLTLLFTFFTKLLTLHMQQDKSEQGIRKSLGNRGFLVKEYMLALRAFPL
QRCIDIIHFVRVADLQVKGITGGDMSDADILRELVFKILHPVPRAMAS