Protein Info for CA264_04905 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00289: Biotin_carb_N
  • amino acids 4 to 112 (109 residues), 160.3 bits, E=6.2e-51
• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 4 to 446 (443 residues), 644.2 bits, E=5.7e-198
• PF02786: CPSase_L_D2
  • amino acids 118 to 324 (207 residues), 271.9 bits, E=1.1e-84
• PF02222: ATP-grasp
  • amino acids 139 to 294 (156 residues), 39.2 bits, E=1.7e-13
• PF07478: Dala_Dala_lig_C
  • amino acids 142 to 293 (152 residues), 46.3 bits, E=1.1e-15
• PF02785: Biotin_carb_C
  • amino acids 338 to 445 (108 residues), 134 bits, E=6.6e-43

Best Hits

Swiss-Prot: 58% identical to PYCA_METJA: Pyruvate carboxylase subunit A (pycA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 72% identity to sli:Slin_3536)

MetaCyc: 54% identical to pyruvate carboxylase subunit A (Methanothermobacter thermautotrophicus Delta H)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

• gluconeogenesis III (9/12 steps found)
• L-leucine degradation I (4/6 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Citrate cycle (TCA cycle)
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1, 6.4.1.4

Use Curated BLAST to search for 6.4.1.1 or 6.4.1.4

Sequence Analysis Tools

See A0A1X9YPP0 at UniProt or InterPro

Protein Sequence (498 amino acids)

>CA264_04905 acetyl-CoA carboxylase biotin carboxylase subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKINKILVANRGEIALRVMRTAKEMGIKTVAVYSEADRNALHVRFADEAVCVGGPKSNE
SYLRGDVIIQVCKDLGVDAIHPGYGFLSENAGFAKAVQEAGLIFIGPSPEAIDLMGSKLA
AKAAVAKYNIPMVPGTESAITDVEEAKQIAQQVGFPILIKASAGGGGKGMRVVEDVASFE
EQMKLAVSEATSAFGDGSVFIEKYIGSPRHIEIQVLGDTHGNIVHLFERECSIQRRHQKV
IEEAPSSVLTPALREEMGRNAVNVAKACDYVGAGTVEFLLDENMNFYFLEMNTRLQVEHP
VTEQITGLDLVKEQILIAEGNPLSFKQEDLEIYGHALELRVYAEDPANNFLPDIGKLETY
KRPQGLGVRVDDGFEQGMEIPIYYDPMIAKLVTFGKDRQEAIDKMLRAIEEYQITGIETT
LPFGSYVLQHEAFVSGNFDTKFIERHFSPDVLQRTPDEGADEIAVALAAMLMNKQKPATS
EATALSETASSWRRNRTR