Protein Info for CA264_04880 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: polyribonucleotide nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 14 to 701 (688 residues), 947.8 bits, see alignment E=1.9e-289 PF01138: RNase_PH" amino acids 15 to 146 (132 residues), 97.3 bits, see alignment E=2.5e-31 amino acids 327 to 460 (134 residues), 98.9 bits, see alignment E=8.1e-32 PF03725: RNase_PH_C" amino acids 149 to 213 (65 residues), 42 bits, see alignment E=1.8e-14 amino acids 464 to 532 (69 residues), 27.6 bits, see alignment E=5.8e-10 PF03726: PNPase" amino acids 245 to 324 (80 residues), 37.6 bits, see alignment E=6.3e-13 PF00013: KH_1" amino acids 563 to 622 (60 residues), 42.9 bits, see alignment 8.3e-15 PF00575: S1" amino acids 628 to 700 (73 residues), 63.4 bits, see alignment E=5.3e-21

Best Hits

Swiss-Prot: 70% identical to PNP_CYTH3: Polyribonucleotide nucleotidyltransferase (pnp) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 70% identity to chu:CHU_1786)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPK3 at UniProt or InterPro

Protein Sequence (712 amino acids)

>CA264_04880 polyribonucleotide nucleotidyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSYNAISKTIFLPDGREVTIETGKLAKQADGSVVVKMGNTMLLAAVVSNKEAREGVDFLP
LSVDYQEKFASSGKIPGGFLRREARLSDYEVLVSRLVDRVLRPLFPSDYHAETQMTINLI
SADTEIMPDALAALAASAALAVSDIPFNGPISEVRVARVDGQLVINPSVSDIQRADIELM
VGASIDSVVMVEGEMNEVSEAEMLEAIQFAHEAIKAQCQAQIELAEMVGKTEKRVYSHET
HDDELRQKVYDATYEKAYAVAKRGSANKSERKEGFGAVLEEFVASLGEEHGYDMGLIKTY
YHDVEKEAVRNMILSDRTRLDGRQLDEIRPIWSEVNYLPATHGSAVFTRGETQSLTTVTL
GTKLDEQMIDSAMVSGTNKFLLHYNFPAFSTGEVRPNRGPGRREVGHGNLALRALKKVLP
PEAENPYTIRIVSDILESNGSSSMATVCAGSLALMDAGVPVKAAVSGIAMGLITDEKTGK
FAVLSDILGDEDHLGDMDFKVAGTNKGITACQMDIKVQGLSYEVLSQALQQANAGRLHIL
NEMSKTISSPNPDYKPHTPRSFNIVIDKEFIGAIIGPGGKVIQQIQKDTGATIIIEEKNE
KGHVNIFASNQESMDQAVGKIKAIAAQPEIGEVYIGKVKSIQPYGAFVEFMPGKDGLLHI
SEIKHERLENMEGVLEIGEEVKVKLIDVDKKTGKFKLSRKAILPKPGAEQNQ