Protein Info for CA264_04810 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: CTP synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 529 (528 residues), 791.4 bits, E=1.9e-242
• PF06418: CTP_synth_N
  • amino acids 4 to 268 (265 residues), 419.2 bits, E=1e-129
• PF00117: GATase
  • amino acids 304 to 528 (225 residues), 138.5 bits, E=3.2e-44
• PF07722: Peptidase_C26
  • amino acids 369 to 511 (143 residues), 27.4 bits, E=4.2e-10

Best Hits

Swiss-Prot: 76% identical to PYRG_CYTH3: CTP synthase (pyrG) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 76% identity to chu:CHU_2536)

MetaCyc: 56% identical to CTP synthetase (Bacillus subtilis subtilis 168)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See A0A1X9YPJ4 at UniProt or InterPro

Protein Sequence (537 amino acids)

>CA264_04810 CTP synthetase (Pontibacter actiniarum KMM 6156, DSM 19842)
MATKYIFVTGGVTSSLGKGIISASLAKLLQARGYSVTIQKFDPYINIDPGTLNPYEHGEC
YVTEDGAETDLDLGHYERFLNVATSQANNVTTGRIYYNVIMQEREGAYLGKTVQVVPHIT
DEIKRRMLLLGESGEFDIVITEIGGCVGDIESLPFIEAVRQLRWELGVNETCVIHLTLLP
YLKAAGELKTKPTQHSVRDLSEAGVQPDILVCRSEHPIPADLRKKIALFCNVKQNSVIES
IDAETIYDVPLLMRKEKLDERVITKLKLMHKADPNLDTWKEFLGRLKNPTSEVNIALVGK
YVELPDAYKSIIESFVHAGSANECKVNIKWFQSENITDENVAGLLQSMDGVLVAPGFGER
GFKGKLEAIRFVRENNIPFMGICLGMQCAAVEFARNVLGLQGAASTEMDPETPHPVIDMM
EDQKQITQMGGTMRLGAYTCELKRGSKAYSIYGKSKISERHRHRYEFNNKYLQAFEEAGM
HATGINPDTGLVEVIELQNHPWFVAAQYHPELKSTVLNPHPLFVKFVKAAINYAKSK