Protein Info for CA264_04805 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 23 (2 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details amino acids 483 to 503 (21 residues), see Phobius details amino acids 518 to 543 (26 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 2 to 338 (337 residues), 102.1 bits, see alignment E=4.8e-33 PF14849: YidC_periplas" amino acids 78 to 340 (263 residues), 82.6 bits, see alignment E=4.7e-27 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 362 to 556 (195 residues), 194.5 bits, see alignment E=1.9e-61 PF02096: 60KD_IMP" amino acids 363 to 557 (195 residues), 182.7 bits, see alignment E=5.3e-58

Best Hits

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 49% identity to mtt:Ftrac_0306)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPL4 at UniProt or InterPro

Protein Sequence (609 amino acids)

>CA264_04805 membrane protein insertase YidC (Pontibacter actiniarum KMM 6156, DSM 19842)
MDRNQAIGFGLIAVLLLAYSFFFTSPEEPVKQKAIQETAKVEQVQTVAVAEEDSLSQARR
AAALGAFGAAATGEASTTTVENQNMVVTFNSKGGQVEEVVLKNYKTYQGEPLTLFDSESS
ETNITFQTKQGKRVQLSDLYFNVSEVKEVAENGKTGKTIAFRADLGNGQYIEQVYTLYDE
NFLMGYKLDFEGLEQQIAGNTITFSWTDRLKQLERDLKQNRAKSTINYFTAEEEFESLSI
AEDKEEALVEQPVKWVANKQNFFTAGIIAGGEFAGAKLVADVDLADSSVVKTLASEMYIP
TADVLSGKGEFMFYFGPNDYNILTQIGNEFDDNLYLGWGIFSYVNKWLIIPAFDFLENYI
TNYGIIILLLVLYIKTILFPLTYKSYVSMAKMKVLKPEIDAIKERNDGDMQKTQMETMKL
YQEMGVSPLSGCLPMLLQMPILFAMFNFFPNSIELRQEPFLWAQDLSTYDVFAKLPFTIP
FYGDHVSMFTLLMTASTILYTWSNNQINSSMQGPMKFYSYLMPVIFMFVLNSFPAGLSFY
YFVSNIVTFGQQAAIRKFVDEKKVRARLEDNKHKIKEKKKKGGPSFTERMQEAMRQAAEQ
EQQKRKAKK