Protein Info for CA264_04765 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13614: AAA_31" amino acids 2 to 179 (178 residues), 233.6 bits, see alignment E=5.2e-73 PF06564: CBP_BcsQ" amino acids 3 to 153 (151 residues), 34.1 bits, see alignment E=7.7e-12 PF10609: ParA" amino acids 3 to 40 (38 residues), 34.6 bits, see alignment 5e-12 PF09140: MipZ" amino acids 4 to 162 (159 residues), 40 bits, see alignment E=1.1e-13 PF01656: CbiA" amino acids 5 to 229 (225 residues), 95.5 bits, see alignment E=8.5e-31 PF00142: Fer4_NifH" amino acids 10 to 76 (67 residues), 31.1 bits, see alignment E=6e-11 PF02374: ArsA_ATPase" amino acids 10 to 60 (51 residues), 27.8 bits, see alignment 5.2e-10

Best Hits

Swiss-Prot: 58% identical to SOJ_BACSU: Sporulation initiation inhibitor protein Soj (soj) from Bacillus subtilis (strain 168)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 77% identity to sli:Slin_0241)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPI6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>CA264_04765 chromosome partitioning protein ParA (Pontibacter actiniarum KMM 6156, DSM 19842)
MGKIIAVANQKGGVGKTTTAINLAASLAALEYKTLLVDADPQANATSGLGFDPATITSSI
YECMVEDVKAEDIILQSPNIEFLDLIPSHIDLVGAEVEMINMDNREEKMRVALSSLKQQY
DYIIIDCSPSLGLITVNSLTAADSVVIPVQCEYFALEGLGKLLNTIKIIQSRLNTELAIE
GILLTMYDVRLRLSNQVVEEVKTHFQQMVFDTIIPRNVKLSESPSFGIPALLHDAESKGA
LSYLNLAREIAEKNSVVLAK