Protein Info for CA264_04740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: arsenate reductase (glutaredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 3 to 113 (111 residues), 137.2 bits, E=1.7e-44
• PF03960: ArsC
  • amino acids 5 to 111 (107 residues), 64.3 bits, E=4.9e-22

Best Hits

Swiss-Prot: 53% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 62% identity to app:CAP2UW1_4244)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (1/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (2/6 steps found)
• arsenic detoxification (yeast) (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See A0A1X9YPK2 at UniProt or InterPro

Protein Sequence (113 amino acids)

>CA264_04740 arsenate reductase (glutaredoxin) (Pontibacter actiniarum KMM 6156, DSM 19842)
MLKIYHNNRCSKSRQTLELIHNAGQEVEVVEYLKTPPSAAELRGLLQKLNMRPEQLLRKG
EAVYKEQFKGKSLTDEEWIQAMAAHPVLIERPIVVKDQKAVLGRPPENVQELL