Protein Info for CA264_04730 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR00628: uracil-DNA glycosylase" amino acids 7 to 215 (209 residues), 285.9 bits, see alignment E=1.1e-89 PF03167: UDG" amino acids 52 to 210 (159 residues), 59.8 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 66% identical to UNG2_BACFR: Uracil-DNA glycosylase 2 (ung2) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 70% identity to chu:CHU_2586)

MetaCyc: 55% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPQ1 at UniProt or InterPro

Protein Sequence (220 amino acids)

>CA264_04730 uracil-DNA glycosylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVKIEESWQNVLQDEFEKPYFKNLVSFVKDEYNSQKVYPAGTQIFNAFQLCPFDKVEVV
ILGQDPYHGPNQANGLAFSVSDEVRTPPSLLNIFKEIKSDLGKDMPATGNLERWAKQGVL
LLNATLTVRAGNAGSHQKKGWEEFTDAVVKKVNDLKENVVFMLWGAYAQKKGAFIDDSKH
LVLKAAHPSPFAADRGFFGSRHFSKANSYLEEHGKKPIDW