Protein Info for CA264_04665 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 88 to 104 (17 residues), see Phobius details TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 6 to 317 (312 residues), 412 bits, see alignment E=1.5e-127 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 7 to 310 (304 residues), 345.6 bits, see alignment E=2.6e-107 PF00814: TsaD" amino acids 25 to 310 (286 residues), 324.5 bits, see alignment E=3.2e-101

Best Hits

Swiss-Prot: 66% identical to TSAD_CYTH3: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 70% identity to dfe:Dfer_3012)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPK4 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CA264_04665 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD (Pontibacter actiniarum KMM 6156, DSM 19842)
MTEPTILAIESSCDETSAAVIRGGKVLSNIVNTQAVHEQYGGVVPELASRAHQQNIIPVV
TQALLKANVEKSELNAVAFTRGPGLLGALLVGCSFAKSFALGLGIPLIEVNHMQAHILAH
FIDEPTPQFPFLCLTVSGGHTQIVLVKDHLTMEIIGQTTDDAVGEAFDKTAKMLGLPYPG
GPMLDKMAAQGNPDAFEFPVGNMPEYNYSFSGIKTSVLYFLRDKTKENPSFVEENIADIC
ASVQKTLIKTLLKKLVKASNDLGVKEVAIAGGVSANSGLRQTLQQYAEKYNWNVYIPAFQ
YCTDNAGMIAIAAHYQYLKGDFATQYVSPEPRLKF