Protein Info for CA264_04655 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF18075: FtsX_ECD" amino acids 53 to 153 (101 residues), 47.9 bits, see alignment E=1.7e-16 PF02687: FtsX" amino acids 176 to 289 (114 residues), 35.6 bits, see alignment E=8.5e-13

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 48% identity to mtt:Ftrac_0776)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPJ8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>CA264_04655 cell division protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MATKVKHVKKKKLGSYPHLMVVFSITVALFVIGLFGLLLIHAGKLSEKVKESIEMQVYLD
RNLTQVQLVRLKKTFAAKEYVAYQNDTAQVRYISKEEGAKAFLDETGEDFMAFLGENPLR
DAYTLRIDADHSSSAMLKSIKLDLEEIDGVHEVQYVESLIESINANIQKISIILIGFAAI
LVLVVTILINNTIKLALYSQRFLIRSMQLVGATSFFIQRPFLNRAAWQGVVSGILASVLL
FVLMQYAYTEITELQLLRNDEQTYILMGALVVIGLIIGFLSSYRSVRKYLRMSLDELY