Protein Info for CA264_04640 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA pseudouridine(55) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 10 to 215 (206 residues), 241.2 bits, see alignment E=4.5e-76 PF01509: TruB_N" amino acids 29 to 177 (149 residues), 189.2 bits, see alignment E=5.7e-60 PF16198: TruB_C_2" amino acids 178 to 221 (44 residues), 45.3 bits, see alignment 7.9e-16

Best Hits

Swiss-Prot: 55% identical to TRUB_PARD8: tRNA pseudouridine synthase B (truB) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 62% identity to mtt:Ftrac_0780)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPM0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>CA264_04640 tRNA pseudouridine(55) synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQYDFAAGEILLINKPLDWTSFDVVKKVRNTIRVKKVGHAGTLDPLASGLLILCTGKFTK
RIDEIQGQEKEYTGIIRLGEVTPSYDRETEVTETRDITHLTAEDIKAAAHTFVGAIEQIP
PIYSAVQIDGKRAYDLARKGKEVELKPRAVTIHAFEITSINGPEVAFKVVCSKGTYIRSL
AHDLGQKLGVGGHLSKLERTRIGEYKLEDALTIEDIVAIRKKQLEEADGSSS