Protein Info for CA264_04605 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 228 to 243 (16 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 310 to 335 (26 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 22 to 288 (267 residues), 154.7 bits, see alignment E=5.4e-49 PF13440: Polysacc_synt_3" amino acids 48 to 336 (289 residues), 37.4 bits, see alignment E=2.7e-13 PF14667: Polysacc_synt_C" amino acids 344 to 426 (83 residues), 49.5 bits, see alignment E=7.8e-17

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 38% identity to cni:Calni_1177)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPJ1 at UniProt or InterPro

Protein Sequence (441 amino acids)

>CA264_04605 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSFLRNILNKISTFATSEYRPLLENFFSLGLIQGANFLLSIITFPYIVRVIGVERFGIIT
LLQTIMLYFVVLTDYGFNLSATKDISVNRKNITRVSNIFSEVIATKFVLLLLSFLILSSS
FLLFPSFKEYWLLTLFSFTIVLGQLLQPTWFYQGIEQMKYITYINILNRALYASGIFVFI
SEPQDYLYINLINGVSLVVGGVISLIIVFRKFGLQFSFPSLTRIRRQLVDAWSIFFATII
ISVSNNTNIVILGIFASPLIIGYYSIAEKVFQIMRTFAAILYQVVYPRVCILAQESFEAL
ANFLHKLLKAIMLVFIPLSLIVFAFADHIVLFIAGKYISEAALVLRIICFGPFMAALNIP
ASQTMLAYKLNNLYTVVLSIGAVINVALNFTLTYHFKAVGTASSIMITETISTGLLYYAL
HRKHPHYTFFLNKAPMKGAKL