Protein Info for CA264_04590 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 222 to 255 (34 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 416 to 433 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 224 to 364 (141 residues), 45 bits, see alignment E=5e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPK9 at UniProt or InterPro

Protein Sequence (443 amino acids)

>CA264_04590 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MESSDRLALPALRRRVVVSTYIIKLLIFGLLYSGFITNFLSVTQINSGTLLIDLLVVLLL
LHLSFKLIAGYYIKLRINKVYFYFLIFWLLLLLLSTIKLFLIDSTPITEGFLGVRNNLFY
MAPLLYIPLFFKRTSSVTDILKLFLHLGLCLTVFSFVQFFLSSKLPDSLLVLRGESVFGF
YNTDIVRPTALLGNTIIYASFTLVLFAFYLTRYLYHRKRTHLFIIFMIGLANLLTFTRAS
IVGLVIVVLVCVFLKYARPTLLFTIKIVCIILTLSTIVSIGFYLNKNSFLVQRLTGKEAS
TQGSTNEHITQIKNAVLYLKEHPIAGAGVGSQGASGDPSKKIITDGYWFQVMLENGVPLG
LLYVLFHFICPLFALTSFYRTEDLLLKKLCMAFVAVSAYFFAASFLNSGFAGRANYISYW
LIFGTLIAQYIIVKKSQNATSRY