Protein Info for CA264_04580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 16 to 52 (37 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 92 to 108 (17 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 406 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 209 to 349 (141 residues), 63.1 bits, see alignment E=1.3e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPH5 at UniProt or InterPro

Protein Sequence (415 amino acids)

>CA264_04580 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLITKKGYKLSNSQLLDFGIIGFILTMPFKIQINSLFLIISALLWIVSGRALSDLKSLLK
FKLYQLYILLYSLYIVGLLYSTNMQAAFSELELKVSLLLLPPILHSLFSQGRAKNRYLFI
FVLACFIAAVSSLFMIFYKIYFLDMYRQPNQPLQIDWVYFSFHLPKQINFHAPYFSMYVM
LSIFILAHWILKEVNNGQTWKILLGLVTIFFFFTFNVLLSSRTALVSGTIILLIGSIAYF
FSKKRYSQAGLVLSLSSILICSLYFNTPYLRRKLEGGTGITQRQQLWRAGFELIKDTPFI
GVGPGDTKDRLAVQYSRMGLSSEAKNRLDPHNQYIQMFLALGVMGILVYTVCLLYLLFTS
LRNSSYLLTAFVLLYILCGTTESVFNSQKGVVLFAFIAGVLAFREREVQFESSFS