Protein Info for CA264_04570 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 16 to 453 (438 residues), 391.1 bits, see alignment E=8.9e-121 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 17 to 456 (440 residues), 423.5 bits, see alignment E=1.5e-130 PF13727: CoA_binding_3" amino acids 58 to 202 (145 residues), 62.1 bits, see alignment E=7.2e-21 PF02397: Bac_transf" amino acids 266 to 451 (186 residues), 215.3 bits, see alignment E=4.8e-68

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY66 at UniProt or InterPro

Protein Sequence (457 amino acids)

>CA264_04570 undecaprenyl-phosphate glucose phosphotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MPVRYSKYIKLIHIIGDVAAIAISIGAAFALDSTKEQPSYLISLLCSLLGWFICTVLLGT
YHIYRTTTRIRVVVTALKALLLYVVLLEAGLNISGTQFIERHTLVYHYCVLVGLIVLWRI
SVTTALRIYRREGYNLRKVIIAGHNEMAQELKHFFKAHPEFGYKFLGSFHNNTDTNDRQY
IGKISDIEEFVKKNEVDEVYCCPFDLTREETSWLINFADNNLLRVKFLPEPGSYTHQQFK
IDFYDILPVLIVRSIPLDDAINQFFKRSFDIVFSLTIITLLLSWLLPVLALLIKLNSKGP
VLFKQVRSGLDNKPFYCFKLRTMYVNTRSNSQLAKRGDSRITPIGAFLRKTSLDELPQFF
NVLLGQMSIVGPRPHMLKADEEYAMVAEKYKVRHFVKPGITGLSQVRGYRGDTTETYQVR
GRIRLDIFYLENWSFYLDLKIIFYTVYNVIKGDKHAF