Protein Info for CA264_04565 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR00442: histidine--tRNA ligase" amino acids 8 to 454 (447 residues), 403.1 bits, see alignment E=6.8e-125 PF13393: tRNA-synt_His" amino acids 97 to 357 (261 residues), 111.7 bits, see alignment E=4.2e-36 PF03129: HGTP_anticodon" amino acids 384 to 463 (80 residues), 61.6 bits, see alignment E=6.4e-21

Best Hits

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPM2 at UniProt or InterPro

Protein Sequence (465 amino acids)

>CA264_04565 histidine--tRNA ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKEKPSIPKGTRDFGPAVVVKRNYIFGVIKRTFEKFGYLPLETPAMEQLSVLTGKYGDE
GDQLIFKILNSGDFLAKTKPEDVEQGAKHLTRKISEKALRYDLTVPFARFVVMNRNEINF
PFKRYQIQPVWRADRPQKGRYREFYQCDADVVGTNSLLCEAEIVQMIDEVLTSLELKDFT
IKINHRGVLAGIAEAIGEKGREGDICVAIDKLDKIGQEGVRKELLERGIAEEAVNKLEPL
YNLSGSNEEKLEQLQSLLGNTAEGQRGLNDLRDVWQYLSQLGSGALSTQNPSGQPRLMLD
VTLARGLSYYTGCIFEVKVNNVSMGSISGGGRYDNLTGMFGMPGVSGVGFSFGVDRIYDV
LEELGLFPGSSQVGTKVLMVQFDKESELYSLPLLQKLRDAGIASELYPEAAKLKKQMSYA
DQKNIPFVLLIGSEEIKSGKLQLRDMKTGEQHALHIDEIIAQLNS