Protein Info for CA264_04550 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nucleoid-associated protein, YbaB/EbfC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 4 to 104 (101 residues), 76.8 bits, see alignment E=6.2e-26 PF02575: YbaB_DNA_bd" amino acids 8 to 97 (90 residues), 96.2 bits, see alignment E=5.5e-32

Best Hits

Swiss-Prot: 46% identical to Y2277_STAS1: Nucleoid-associated protein SSP2277 (SSP2277) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: K09747, hypothetical protein (inferred from 56% identity to chu:CHU_2675)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPF0 at UniProt or InterPro

Protein Sequence (111 amino acids)

>CA264_04550 nucleoid-associated protein, YbaB/EbfC family (Pontibacter actiniarum KMM 6156, DSM 19842)
MFDMFGMMGKIKEAQAKMKEAQEKLKDVTVTAESGAGLVKATVNGQRQLLKIEIDESIMN
VSDREMVNDLVVAAVNNAMLTAGERAQEEMRKHTEGLIPNIPGLDLGSFGL