Protein Info for CA264_04495 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details PF06580: His_kinase" amino acids 139 to 217 (79 residues), 91.3 bits, see alignment E=1.9e-30

Best Hits

KEGG orthology group: None (inferred from 40% identity to phe:Phep_0216)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXN2 at UniProt or InterPro

Protein Sequence (332 amino acids)

>CA264_04495 histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MITWLLFGAWVFYFLYGNSTLSFGKVLDVLTGMLFNILIFYFNWYVLIPKYLARNRILLY
AAAVLTTLLAIAVVRAPLDFFVFEEYNREMTALYSYERIVQYMMGGLVLIFISSALKVTS
NYIRNERRNKELETQKLTAELAFLKSQVNPHFLFNTLNNIYSLAYKQHPETPDAIMKLSL
LMRYMLYESNDTLVSLEKEVDHINNFIDLQKLRLREQTSIKFNIQGNLEGKQIAPMLLMT
LVENAFKHGLVSKNEIGIILNLVVLDDSLLFSTINNTSQHKRREFGGIGLENLQRRLNLL
YSKRHELTSEEKEGTFYATLKLYFKPTNKIKL