Protein Info for CA264_04390 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 24 to 40 (17 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details PF02405: MlaE" amino acids 53 to 260 (208 residues), 244.7 bits, see alignment E=3.8e-77

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 74% identity to sli:Slin_1812)

Predicted SEED Role

"ABC transporter, permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPE7 at UniProt or InterPro

Protein Sequence (271 amino acids)

>CA264_04390 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MGLQESKADTGKKRKYVLTRRMDRLFLELYRIYAFHIRFFKEVLVPPYELKEVVRQCYEI
GVRSLPLISLTGFIIGIVFTNQSRPSLAEFGATSWLPSLVSIAIVRALAPLVTALIAAGR
VGSNIGAELGSMRVTEQIDAMEVSATNPFNFLVVTRVLATTFMIPALAMYTILVALLGAY
LNVSQNELTSFATYITQVFDAITFLDVFSSIIKSFIFGFTIGMVGCYKGYNSSKGTEGVG
KAANSSVVTAMFMVFIEELLALQVINLLRAM