Protein Info for CA264_04295 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 235 to 254 (20 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 382 to 409 (28 residues), see Phobius details amino acids 427 to 452 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 259 to 458 (200 residues), 95.1 bits, see alignment E=2.3e-31

Best Hits

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPE2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CA264_04295 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MRSYLLRRLLLALPAFWLLATVVFLLSRMLPGSFGEERILETEAGFYTKGNDSSRQAAYV
QYLQKTGQDKPLFYFSLSPSPLPDTLYRVFPEARRQQLQRLTFRGGSWPAVAAFDAAVQQ
LVQHARQNGQHNLEPHLQVLRYSTDSHKLRLALKALAGTDTDVTTQALTRATATKFGSVE
SHFSTYGFLLPTPRWNGTDNQYRTWLTGLFYGDFGRSYRTNRPVVEMLWEAIGNTFWLLL
CSMLFTLALALELSVQLSKRKMKWLRRMVLPSLFVVDSIPLFVLALLLLVLLANPDFLQL
FPVYGMGYFATEPLPLWQRLGQWLQFMALPIISMVLVNLPYLTNQIYTSLQASLNANYTR
TAKAKGLPEHLVIRRHALRNALLPVITIVSDFLPALVDGSIIIETIFAIPGIGRLLVESV
LARDYPVLTTIVLLVLAVRMLAYALAEAAYAWADPRIKQKLA