Protein Info for CA264_04290 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 192 to 346 (155 residues), 73.5 bits, see alignment E=9.4e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPG7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CA264_04290 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKVWQSIKTLWKAHLGFKLAVLYLLLLLTLALLLPLLPLNFGPNYLDLEHAFLSPFSSE
ALASGHVFGTDNLGRDLLANMLYGARTAFFIALPVMSLATLLGLLLGTGAGFYGANGLVL
PRHRLLFFALALLLVLYYGLYLPLYVFKLGMGLAAAGLSVAFLLVAIALSWAATALLLKR
FPFWRKANAVPVDQFVLRLTEALSSIPRFVLILVLASFVPPSVALLSLLLVLTLWPSAAR
LARAEMLRIKGLPYFEAAQSIGSSPRRLLWRHALPNLLGPVLVAFTFGLGGLLALESTLS
FLNIGVPTTLVSWGRTISNIRGNTSAWWLVALPGGLLSLTVLALYTCSHYLTKEFRTKSK
G