Protein Info for CA264_04270 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH:ubiquinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to NUOA_NITOC: NADH-quinone oxidoreductase subunit A (nuoA) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 61% identity to cpi:Cpin_3825)

MetaCyc: 48% identical to NADH-quinone oxidoreductase subunit A (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
Fe(II) oxidation (2/6 steps found)
NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPD5 at UniProt or InterPro

Protein Sequence (143 amino acids)

>CA264_04270 NADH:ubiquinone oxidoreductase subunit A (Pontibacter actiniarum KMM 6156, DSM 19842)
MYALEENNTLLWPLLVYGAIVLSLVGLILGLSYVLGSRHNDRATGEPYEGGIVSEGTART
RFSSQFYLVAMLFVIFDVETVFILSWAIAFRELGWYGYAGVAVFMLMLAVVLVYEWRNGA
LDFGPDGRKILAAYKRLMQKPAA