Protein Info for CA264_04265 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 87 to 102 (16 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 29 to 169 (141 residues), 215.6 bits, see alignment E=1.3e-68 PF01058: Oxidored_q6" amino acids 55 to 162 (108 residues), 94 bits, see alignment E=3.2e-31

Best Hits

Swiss-Prot: 69% identical to NUOB1_NITOC: NADH-quinone oxidoreductase subunit B 1 (nuoB1) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 81% identity to cpi:Cpin_3824)

MetaCyc: 66% identical to NADH-quinone oxidoreductase subunit B (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP89 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA264_04265 NADH-quinone oxidoreductase subunit B (Pontibacter actiniarum KMM 6156, DSM 19842)
MKWWLSKPDDPVSATSGTSSYEETVQQSVMLSTMQDLLAWGRKNSMWPFHFGLSCCFVEM
ATSMTPKYDVARFGAEVIRGTPREADVMIIAGTVFIKMAPIIKRLHEQMMEPRWVISMGS
CANSGGMFDIYSVVQGVDKFLPVDVYVPGCPPRPDAFMEGLTLLAESVGKEKRPLSWTIG
EQGIIRPEKPDVKERRQEARAKMVKFRSPDEV