Protein Info for CA264_04250 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH oxidoreductase (quinone) subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 108 to 125 (18 residues), see Phobius details TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 13 to 416 (404 residues), 585.4 bits, see alignment E=2.1e-180 PF01512: Complex1_51K" amino acids 46 to 219 (174 residues), 150.3 bits, see alignment E=6.4e-48 PF10531: SLBB" amino acids 244 to 290 (47 residues), 39.2 bits, see alignment 7.4e-14 PF10589: NADH_4Fe-4S" amino acids 332 to 415 (84 residues), 87.6 bits, see alignment E=6.2e-29

Best Hits

Swiss-Prot: 59% identical to NUOF_SALTY: NADH-quinone oxidoreductase subunit F (nuoF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 73% identity to cpi:Cpin_3821)

MetaCyc: 59% identical to NADH:quinone oxidoreductase subunit F (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPA7 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CA264_04250 NADH oxidoreductase (quinone) subunit F (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKPLTQHIVPGRKPLSLKEYEKVGGYQSVRKVLQDMAPAEVQALVKDANLRGRGGAGFN
TGLKWSFVPMGPEAATPKYLVANADEMEPGTFKDRLLLEGNPHQLIEGMIVAAYAIQASI
SYVFLRWAYKLAAQEITQAIHEAYKAGYLGKNILGTGFSLEMHLHTGVGRYMCGEETALL
NALEGKRANPRAKPPFPQVSGLFGKPTIVNNVETLCNLPHIINNGAEWFRKLGLTEDAGT
KLYGVSGRVKKPGCWELPMGTTIREILEDYAGGMQDGYLFKGLLPGGASTDFLVEEHLDL
PMDYGAIQAAGSRMGTGTMIILDDQTCPVGFVHNLQHFFAQESCGFCTPCREGLPWVEKI
LLAIDKGEGKPEHLLTLDFHTKYLGPGNTFCALAPGAMEPLQSALKYFREDFERHIHEHH
CPWSKSKAWQPSI