Protein Info for CA264_04220 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 54 (24 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 416 to 441 (26 residues), see Phobius details amino acids 455 to 473 (19 residues), see Phobius details amino acids 507 to 528 (22 residues), see Phobius details amino acids 549 to 570 (22 residues), see Phobius details amino acids 607 to 627 (21 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 3 to 624 (622 residues), 699.6 bits, see alignment E=2.7e-214 PF00662: Proton_antipo_N" amino acids 68 to 118 (51 residues), 64.4 bits, see alignment 6.8e-22 PF00361: Proton_antipo_M" amino acids 134 to 428 (295 residues), 282.1 bits, see alignment E=5.2e-88

Best Hits

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 59% identity to nmu:Nmul_A1023)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPC3 at UniProt or InterPro

Protein Sequence (628 amino acids)

>CA264_04220 NADH-quinone oxidoreductase subunit L (Pontibacter actiniarum KMM 6156, DSM 19842)
MENLLWVIPALPFLGAILLVLFGSRLPRSGVAALGVGSVGVAALSTVLLGLQFLAERPAF
YHQEVWQWFNVAGFRPSVAFHLDALSMVFIFVITFVGFLIHVYSTAYMAEETDFSRFFAC
MNLFVGSMLLLVMADNLLLLYMGWEGVGLCSYLLIGFWYKEPANGYAARKAFTITRVGDT
AMAIGLFLLFQLFGTLNIQAILTDAPQVWQVGAGGALLVALLLLGGAVGKSGQLPLQTWL
PDAMAGPTPVSALIHAATMVTAGVYLIARMYVIFELAPVAQLTVAVVGAVTLLVAGFSAL
TQYDLKRVLAYSTISQIGYMFLALGVGAWSAGIFHFMIHAFFKALLFLCAGAIILALHHQ
QDMRQMGGLRKSMPVVFWTFLIGAASLAALPIITAGFYSKDQILWYTLAGPSGSVWLYAA
GLAGAFLTSIYTFRMVFMTFYGAPKTPVAHPPGKAITVPLVILAVLSLAGGFIELPHNFG
HVALFSDLLAPVLPGIRAAQALEANEWLFQVLAAVVSLGGVLVAYLYYQQSPALLQRLER
SNFAMRLHRFWFSGWGFDALYNTLFVRPYVYLAHLNKGDVIDSFYTGVARLAEGFHVMLS
QTQSGVLRNYVMGVVVGAIMILTISLLL