Protein Info for CA264_04200 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation-efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 293 (280 residues), 227.4 bits, see alignment E=1.1e-71 PF01545: Cation_efflux" amino acids 17 to 211 (195 residues), 154.2 bits, see alignment E=3.9e-49 PF16916: ZT_dimer" amino acids 216 to 292 (77 residues), 72.8 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: None (inferred from 54% identity to gfo:GFO_1752)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPA3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>CA264_04200 cation-efflux pump (Pontibacter actiniarum KMM 6156, DSM 19842)
MENQPQATTHQGLKTTLIGILFSAFLAILKAVGGIFGHSFALIADAIESTADIFTSTMLW
LGLKWSSKPADHNHPYGHGKAEALVAIGIALALCAAAILIGRESINNIQSPHKSPAPYTL
IILLVVIVTKELLYRFVHKTGLEANSEAVKADAFHHRSDAITSGAAFIGVTIGIVGGKGY
EVADDWAALLAAAIILINAYKIFRPAIGELLDEELDPALNRRVAQLAGEIPAVVKVQKCH
TRKMGVMNHADMHIWVDKNMTVEQGHVVAHAVKDNIQQHLPQFIDVMIHVEPTDAVD