Protein Info for CA264_03990 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: alkyl hydroperoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 29 to 32 (4 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details PF00578: AhpC-TSA" amino acids 81 to 191 (111 residues), 70 bits, see alignment E=3.7e-23 PF08534: Redoxin" amino acids 83 to 200 (118 residues), 72.7 bits, see alignment E=5.9e-24 PF13905: Thioredoxin_8" amino acids 99 to 189 (91 residues), 49.3 bits, see alignment E=1e-16

Best Hits

Predicted SEED Role

"Cytochrome c-type biogenesis protein ResA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YPB2 at UniProt or InterPro

Protein Sequence (214 amino acids)

>CA264_03990 alkyl hydroperoxide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKYKFSLKNIPAWAVMLAIFGTLYLTGLHTEAIGQVQRLLLATGIRKADVPAVATAESA
VVSSETATGGAANSGHMAGKGFKMRTLDGSTVSFESLKGKVIFLNIWATWCPPCVAEMPN
IQSLYEKVGSDKIAFVMLSVDEGGMEKVQKFIAKKGFTFPVYMPAGQLPQEFYSNAIPTT
FIISPDGQVVARQEGMAEYDTKEVRDFLQSMARE