Protein Info for CA264_03950 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR04169: alkylhydroperoxidase/carboxymuconolactone decarboxylase family protein" amino acids 3 to 111 (109 residues), 193.5 bits, see alignment E=7.1e-62 PF02627: CMD" amino acids 22 to 102 (81 residues), 67.7 bits, see alignment E=3.6e-23 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 39 to 89 (51 residues), 38.2 bits, see alignment E=7.7e-14

Best Hits

KEGG orthology group: None (inferred from 69% identity to zpr:ZPR_4188)

Predicted SEED Role

"Carboxymuconolactone decarboxylase (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP81 at UniProt or InterPro

Protein Sequence (111 amino acids)

>CA264_03950 4-carboxymuconolactone decarboxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKTYYNPADLSKFGNISELQPEMGRKFFDYYGEVFKEGALTAREKALIALAVSHAVQCP
YCIDAYSTDCLEKGADENQMMEAVHVAAAIKGGAALVHGVQMMNKIKELTM