Protein Info for CA264_03910 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: family 2 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 270 to 286 (17 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 37 to 267 (231 residues), 88.3 bits, see alignment E=1.8e-28 PF00535: Glycos_transf_2" amino acids 40 to 209 (170 residues), 91.2 bits, see alignment E=1.9e-29 PF10111: Glyco_tranf_2_2" amino acids 41 to 232 (192 residues), 29.2 bits, see alignment E=1.7e-10 PF13506: Glyco_transf_21" amino acids 106 to 266 (161 residues), 73.4 bits, see alignment E=4.3e-24 PF13632: Glyco_trans_2_3" amino acids 128 to 343 (216 residues), 66 bits, see alignment E=1.1e-21

Best Hits

Predicted SEED Role

"polysaccharide-forming b-glycosyltransferase-related protein, glycosyltransferase family 2 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP51 at UniProt or InterPro

Protein Sequence (363 amino acids)

>CA264_03910 family 2 glycosyl transferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIVSVAYFILYFSLFLILLALLVFNRKRYTFKHTQHPRVSILIAARNEEHTILRCLHALE
ALDYPKGKLEVLIGDDASTDNTRAVIDRFIQDKPHYTCITVTHTLGKAKGKANVLAHLAK
LATTEYFFYTDADIAVPPEWVKAMLAALTEEVGVVTGITTIAGDSFFARLQAMDWLYVLG
LMQVVSDLRLPVTAMGNNMLLRRRAYEQVGGFESIDFTITEDIAIFNQVLRRGWRFRNIY
DRQVLALSTPAATFKLFLHQRKRWMRGSMHLPFYMAVVFVLHSAYYPVLLPFFAYTSVGV
MLSIFAFKLLLQSLYLHVCLRRLGRSVRWYMYLFFELYLVVSSVILIVYFFLPVKTVWKG
RKY