Protein Info for CA264_03890 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: family 2 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13641: Glyco_tranf_2_3
  • amino acids 41 to 271 (231 residues), 64.9 bits, E=2.6e-21
• PF00535: Glycos_transf_2
  • amino acids 42 to 213 (172 residues), 77.6 bits, E=2.9e-25
• PF10111: Glyco_tranf_2_2
  • amino acids 42 to 140 (99 residues), 30.3 bits, E=7.5e-11
• PF13506: Glyco_transf_21
  • amino acids 105 to 271 (167 residues), 35.1 bits, E=2.4e-12
• PF13632: Glyco_trans_2_3
  • amino acids 130 to 350 (221 residues), 60.1 bits, E=7.1e-20

Best Hits

KEGG orthology group: None (inferred from 46% identity to dfe:Dfer_2026)

Predicted SEED Role

"N-acetylglucosaminyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See A0A1X9YP74 at UniProt or InterPro

Protein Sequence (377 amino acids)

>CA264_03890 family 2 glycosyl transferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTWLLTLVLLAYGWIIVRRWWAWQKMPVVPAPAAYQPVTPVTVIIPVRNEANHILHLLAD
LDRQRYPKELLEVLVVDDSSEDETAACVAAFAAESTLPVKLFQLHDYVKQEGKKAAVQHG
VAQAQGELLVFTDGDCRVGEEWLRSYAYLYETERPYFISGPVSFRPTPTHFERMQLVEFA
SLIGIGGASIALGKPNMCNGANLAYRKDVFEKVGGFAGNEHIASGDDEFLLHKVDKSFSG
KVKFLKNPKAIVYTEARKTLVSFVQQRVRWASKWKSYQSVPVQLVALCVFLVNFLLFLAI
PLVLWGSLPLGAFLSAYAVKFAIDFLFLSLILGFTGQQKYLWYMLPLQLVYIPYVVFTAI
FGLLGHYRWKGRSIRTL