Protein Info for CA264_03855 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 286 to 305 (20 residues), see Phobius details amino acids 312 to 336 (25 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details amino acids 421 to 447 (27 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 23 to 447 (425 residues), 328.9 bits, see alignment E=2.4e-102 PF03448: MgtE_N" amino acids 32 to 134 (103 residues), 76 bits, see alignment E=4.8e-25 PF00571: CBS" amino acids 200 to 255 (56 residues), 31.9 bits, see alignment 2e-11 PF01769: MgtE" amino acids 320 to 443 (124 residues), 113.3 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 61% identity to mtt:Ftrac_3194)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP39 at UniProt or InterPro

Protein Sequence (450 amino acids)

>CA264_03855 magnesium transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MQVEITREYVDQVEEAIERQDRDFILSTMADMHPADITTVLYELDSNEARYLLDLLPSEL
GSEILSDLDDDIRNEFLDSFTSQEIARYVNLMDSDDAVDILNEQSVQTREEVIALLDNEE
KAAAILDLLHYEEDCAGGLMAKELIKVNLNWRVRQCIDEIRRQAEQVERFYTVYVVDNRD
TLLGRVSVKKLLLSKDDTQVKDIYSEDVISIESYKDESEVVNVMQRYDLEAIPVVNIQGR
LLGRITIDDVVDVMQEQAELSRQLMTGISENVEEDDSVLRISRARLPWLVIGMVGGMLAA
QFMGMFENDIALLPALALFVPLITATGGNVGIQSSSIIIQTLSSNEVMFDNIGKRFLKVL
LVALLNAAIISLLVFSLTYLFRRDISLSLVVSMALFSVVMLASLMGTITPMILDKFGINP
AVAAGPFITTANDLLGLAIYFGVAHLLYSL